• Featured Product
  • KD/KO Validated

CHAC1 Polyclonal antibody

CHAC1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 15207-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, hamster and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Blocks Notch protein, Botch, Cation transport regulator-like protein 1, EC:4.3.2.7, Gamma-GCG 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells, CHO cells, U-251 cells, C6 cells, RAW 264.7 cells
Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15207-1-AP targets CHAC1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, hamster samples.

Tested Reactivity human, mouse, rat, hamster
Cited Reactivityhuman, mouse, rat, chicken, yeast
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7360

Product name: Recombinant human CHAC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-222 aa of BC001847

Sequence: MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV

Predict reactive species
Full Name ChaC, cation transport regulator homolog 1 (E. coli)
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC001847
Gene Symbol CHAC1
Gene ID (NCBI) 79094
RRIDAB_2878118
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BUX1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHAC1(Cation transport regulator-like protein 1) was identified in a co-regulated group of genes enriched for components of the ATF4 (activating transcription factor 4) arm of the unfolded protein response pathway. CHAC1 is a proapoptotic ER stress protein downstream of the pancreatic EIF2α kinase-ATF4 pathway that appears to be important for human physiology and disease(PMID: 19109178). In addition, the study found that high CHAC1 expression is associated with a bad prognosis hinting that CHAC1 may have a possible prognostic significance in breast cancer(PMID: 35930144). The predicted molecular weight of CHAC1 is 24 kDa, and the molecular weight detected by Proteintech is 38 kDa (PMID: 39368995).

Protocols

Product Specific Protocols
IHC protocol for CHAC1 antibody 15207-1-APDownload protocol
WB protocol for CHAC1 antibody 15207-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Proc Natl Acad Sci U S A

Consequences of poly(ethylene oxide) and poloxamer P188 on transcription in healthy and stressed myoblasts

Authors - Adelyn A Crabtree
mouseWB

Cell Mol Gastroenterol Hepatol

Hepatic TGFβr1 Deficiency Attenuates Lipopolysaccharide/D-Galactosamine-Induced Acute Liver Failure Through Inhibiting GSK3β-Nrf2-Mediated Hepatocyte Apoptosis and Ferroptosis.

Authors - Sha Huang
humanWB

Free Radic Biol Med

High-fat diet aggravates colitis-associated carcinogenesis by evading ferroptosis in the ER stress-mediated pathway.

Authors - Xiaoli Zhang
humanWB

Lung

ETS1 Ameliorates Hyperoxia-Induced Bronchopulmonary Dysplasia in Mice by Activating Nrf2/HO-1 Mediated Ferroptosis

Authors - Min Yang
humanWB

Front Oncol

Development and validation of an endoplasmic reticulum stress-related molecular prognostic model for breast cancer

Authors - Pengyu Fan
humanIHC

J Cell Mol Med

Ferroptosis-related gene NOX4, CHAC1 and HIF1A are valid biomarkers for stomach adenocarcinoma.

Authors - Ruoxi Xiao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Zach (Verified Customer) (08-29-2025)

Pretty great experience with this antibody, gave a prominent and specific band between 25-35kDa in models of acute pancreatitis.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: pancreas, acinar cells
Loading...
||
New chat Able
正在加载,请稍候...