• Featured Product
  • KD/KO Validated

CHAC2 Polyclonal antibody

CHAC2 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 16304-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Glutathione-specific gamma-glutamylcyclotransferase 2, Gamma-GCG 2, EC:4.3.2.7, Cation transport regulator-like protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, Raji cells
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16304-1-AP targets CHAC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9281

Product name: Recombinant human CHAC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-184 aa of BC019239

Sequence: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI

Predict reactive species
Full Name ChaC, cation transport regulator homolog 2 (E. coli)
Calculated Molecular Weight 184 aa, 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC019239
Gene Symbol CHAC2
Gene ID (NCBI) 494143
RRIDAB_2229405
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WUX2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHAC2 is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. CHAC2 is involved in continuous, basal turnover of cytosolic glutathione(PMID: 27913623).

Protocols

Product Specific Protocols
IF protocol for CHAC2 antibody 16304-1-APDownload protocol
WB protocol for CHAC2 antibody 16304-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
pigWB

Cells

Adh Promotes Actinobacillus pleuropneumoniae Survival in Porcine Alveolar Macrophages by Inhibiting CHAC2-Mediated Respiratory Burst and Inflammatory Cytokine Expression

Authors - Junhui Zhu
mouseWB

Environ Toxicol

Naringin alleviates acetaminophen-induced acute liver injury by activating Nrf2 via CHAC2 upregulation.

Authors - Xiaohan Zhai
  • KD Validated
human,mouseWB,IHC

J Cancer

CHAC2 promotes lung adenocarcinoma by regulating ROS-mediated MAPK pathway activation

Authors - Weilin Peng
  • KO Validated
humanWB

Mol Neurobiol

NUS1 Variants Cause Lennox-Gastaut Syndrome Related to Unfolded Protein Reaction Activation

Authors - Nan-Xiang Shen
ratIHC,IF

J Mol Histol

SGLT2 inhibitor downregulated oxidative stress via activating AMPK pathway for cardiorenal (CR) protection in CR syndrome rodent fed with high protein diet

Authors - Chih-Chao Yang
ratWB,IHC,IF

Int J Biol Sci

Febuxostat therapy improved the outcomes of cardiorenal syndrome rodent through alleviating xanthine oxidase-induced oxidative stress and mitochondrial dysfunction

Authors - Chih-Chao Yang
Loading...
||
New chat Able
正在加载,请稍候...