CHAC2 Polyclonal antibody

• 

  WB analysis using 16304-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16304-1-AP (CHAC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 16304-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CHAC2 antibody (16304-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

CHAC2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16304-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Glutathione-specific gamma-glutamylcyclotransferase 2, Gamma-GCG 2, EC:4.3.2.7, Cation transport regulator-like protein 2

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IHC: See 3 publications below
• IF: See 2 publications below

Product Information

16304-1-AP targets CHAC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9281

  Product name: Recombinant human CHAC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC019239

  Sequence: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI

• Full Name: ChaC, cation transport regulator homolog 2 (E. coli)
• Calculated Molecular Weight: 184 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC019239
• Gene Symbol: CHAC2
• Gene ID (NCBI): 494143
• RRID: AB_2229405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WUX2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHAC2 is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. CHAC2 is involved in continuous, basal turnover of cytosolic glutathione(PMID: 27913623).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Cells; Adh Promotes Actinobacillus pleuropneumoniae Survival in Porcine Alveolar Macrophages by Inhibiting CHAC2-Mediated Respiratory Burst and Inflammatory Cytokine Expression; Authors - Junhui Zhu
mouse	WB	Environ Toxicol; Naringin alleviates acetaminophen-induced acute liver injury by activating Nrf2 via CHAC2 upregulation.; Authors - Xiaohan Zhai ; KD Validated
human,mouse	WB,IHC	J Cancer; CHAC2 promotes lung adenocarcinoma by regulating ROS-mediated MAPK pathway activation; Authors - Weilin Peng ; KO Validated
human	WB	Mol Neurobiol; NUS1 Variants Cause Lennox-Gastaut Syndrome Related to Unfolded Protein Reaction Activation; Authors - Nan-Xiang Shen
rat	IHC,IF	J Mol Histol; SGLT2 inhibitor downregulated oxidative stress via activating AMPK pathway for cardiorenal (CR) protection in CR syndrome rodent fed with high protein diet; Authors - Chih-Chao Yang
rat	WB,IHC,IF	Int J Biol Sci; Febuxostat therapy improved the outcomes of cardiorenal syndrome rodent through alleviating xanthine oxidase-induced oxidative stress and mitochondrial dysfunction; Authors - Chih-Chao Yang