CHAF1A Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CHAF1A Recombinant monoclonal antibody, PBS Only (88451-1-PBS)

CHAF1A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88451-1-PBS

Clone No.260852B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CAF, CAF 1, CAF 1 subunit A, CAF I 150 kDa subunit, CAF I p150

• 

  WB analysis using 88451-1-RR (same clone as 88451-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88451-1-RR (CHAF1A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88451-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88451-1-PBS targets CHAF1A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10536

  Product name: Recombinant human CHAF1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 607-956 aa of BC067093

  Sequence: EEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS

• Full Name: chromatin assembly factor 1, subunit A (p150)
• Calculated Molecular Weight: 956 aa, 107 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC067093
• Gene Symbol: CHAF1A
• Gene ID (NCBI): 10036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13111
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chromatin assembly factor 1 (CAF1) is the only histone chaperone known to assemble histones H3 and H4 onto newly synthesized DNA both in vitro and in vivo [PMID:17065558]. The 938 amino acid multidomain p150 (CHAF1A) binds via its C-terminal third to p60, which is an essential step for nucleosome assembly because knocking down either subunit disrupts the activity [PMID:14519857]. In addition, CAF1 facilitates DNA synthesis depending on the binding of the N-terminal 31 residues of p150 to the proliferating cell nuclear antigen (PCNA), which acts as a sliding clamp to stimulate the processivity of DNA polymerase [PMID:10648606]. CHAF1A regulates the formation of heterochromatin in mammalian cells during replication and in plants it maintains the transcription of certain subsets of genes. Furthermore, CHAF1A exists in a chromatin-remodeling complex WINAC, which coactivates ligand-induced transactivation function of the vitamin D receptor [PMID:12837248]. CHAF1A protein exists some phosphorylation sites, which may affect its theoretical molecular weight when tested.And a 150 kDa band was recognized (PMID:27445493).