CHAF1A Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CHAF1A Recombinant monoclonal antibody, PBS Only (Detector) (88451-2-PBS)

CHAF1A Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 88451-2-PBS

Clone No.260852A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

• 

  Sandwich ELISA sample test of MP03508-1

  The mean CHAF1A concentration was determined to be 3,498.2 pg/mL in HeLa cell extract based on a 1.2 mg/mL extract load, 6,348.2 pg/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load and 715.2 pg/mL in PC-3 cell extract based on a 1.2 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03508-1

  Sandwich ELISA standard curve of MP03508-1, Human CHAF1A Recombinant Matched Antibody Pair - PBS only. 88451-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag10536. 88451-2-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP03508-1

  The mean CHAF1A concentration was determined to be 29.6 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load, PC-3 cell extract were served as a negative control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP03508-1

  Cytometric bead array standard curve of MP03508-1, CHAF1A Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 88451-3-PBS. Detection antibody: 88451-2-PBS. Standard: Ag10536. Range: 0.469-60 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88451-2-PBS targets CHAF1A as part of a matched antibody pair:

MP03508-1: 88451-3-PBS capture and 88451-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10536

  Product name: Recombinant human CHAF1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 607-956 aa of BC067093

  Sequence: EEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS

• Full Name: chromatin assembly factor 1, subunit A (p150)
• Calculated Molecular Weight: 956 aa, 107 kDa
• GenBank Accession Number: BC067093
• Gene Symbol: CHAF1A
• Gene ID (NCBI): 10036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13111
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.