Product Information
60475-4-PBS targets CHCHD10 as part of a matched antibody pair:
MP50651-2: 60475-3-PBS capture and 60475-4-PBS detection (validated in Cytometric bead array)
MP50651-3: 60475-4-PBS capture and 60475-1-PBS detection (validated in Cytometric bead array)
MP50651-4: 60475-4-PBS capture and 60475-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22598 Product name: Recombinant human CHCHD10 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 82-142 aa of BC065232 Sequence: QPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP Predict reactive species |
| Full Name | coiled-coil-helix-coiled-coil-helix domain containing 10 |
| Calculated Molecular Weight | 14 kDa |
| GenBank Accession Number | BC065232 |
| Gene Symbol | CHCHD10 |
| Gene ID (NCBI) | 400916 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8WYQ3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |







