CHCHD10 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CHCHD10 Recombinant monoclonal antibody, PBS Only (87812-1-PBS)

CHCHD10 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87812-1-PBS

Clone No.253308A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CoraLite® Plus 488-conjugated CHCHD10 Polyclonal antibody, C22orf16, Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial, N27C7 4, Protein N27C7 4

• 

  WB analysis using 87812-1-RR (same clone as 87812-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87812-1-RR (CHCHD10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87812-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87812-1-PBS targets CHCHD10 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22598

  Product name: Recombinant human CHCHD10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 82-142 aa of BC065232

  Sequence: QPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP

• Full Name: coiled-coil-helix-coiled-coil-helix domain containing 10
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC065232
• Gene Symbol: CHCHD10
• Gene ID (NCBI): 400916
• RRID: AB_3745763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WYQ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHCHD10 is a mitochondrial protein that is enriched at cristae junctions in the intermembrane space and is likely involved in mitochondrial genome stability and maintenance of cristae junctions. Mutations in CHCHD10 have recently been described as a cause of frontotemporal dementia (FTD) comorbid with amyotrophic lateral sclerosis (ALS).