Product Information
66584-2-PBS targets CHCHD5 as part of a matched antibody pair:
MP50619-1: 66584-2-PBS capture and 66584-3-PBS detection (validated in Cytometric bead array)
MP50619-2: 66584-2-PBS capture and 66584-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22534 Product name: Recombinant human CHCHD5 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-110 aa of BC004498 Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS Predict reactive species |
| Full Name | coiled-coil-helix-coiled-coil-helix domain containing 5 |
| Calculated Molecular Weight | 110 aa, 12 kDa |
| GenBank Accession Number | BC004498 |
| Gene Symbol | CHCHD5 |
| Gene ID (NCBI) | 84269 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | Q9BSY4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
