CHD5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHD5 Polyclonal antibody, PBS Only (22725-1-PBS)

• 

  WB analysis using 22725-1-AP (same clone as 22725-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22725-1-AP (CHD5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22725-1-PBS in a different storage buffer formulation.

CHD5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22725-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ATP dependent helicase CHD5, ATP-dependent helicase CHD5, CHD 5, CHD-5, Chromodomain-helicase-DNA-binding protein 5

---

Product Information

22725-1-PBS targets CHD5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18621

  Product name: Recombinant human CHD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1540-1709 aa of BC148803

  Sequence: GEVISSDPNTPVPASPAHLLPAPLGLPDKMEAQLGYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSRGDSSELRPDDTKAEEKEPIETQQNGDKEEDDEGKKEDKKGKFKFMFNIAD

• Full Name: chromodomain helicase DNA binding protein 5
• Calculated Molecular Weight: 1954 aa, 223 kDa
• Observed Molecular Weight: 150-160 kDa
• GenBank Accession Number: BC148803
• Gene Symbol: CHD5
• Gene ID (NCBI): 26038
• RRID: AB_3669403
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8TDI0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.