CHI3L2 Polyclonal antibody

• 

  WB analysis of U-87 MG using 27363-1-AP

  WB result of CHI3L2 antibody (27363-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-CHI3L2 transfected U-87 MG cells.

• 

  WB analysis using 27363-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27363-1-AP (CHI3L2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

CHI3L2 Polyclonal Antibody for WB, ELISA

Cat No. 27363-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CHI3 L2, chitinase 3 like 2, Chitinase-3-like protein 2, YKL39, YKL-39

---

Tested Applications

• Positive WB detected in: HeLa cells, U-87 MG cells, NCCIT cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27363-1-AP targets CHI3L2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26386

  Product name: Recombinant human CHI3L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 37-174 aa of BC011460

  Sequence: SQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKST

• Full Name: chitinase 3-like 2
• Calculated Molecular Weight: 390 aa, 44 kDa
• Observed Molecular Weight: 44-48 kDa
• GenBank Accession Number: BC011460
• Gene Symbol: CHI3L2
• Gene ID (NCBI): 1117
• RRID: AB_3669597
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15782
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHI3L2 (Chitinase-3-Like Protein 2), also known as YKL-39, is a member of the chitinase-like protein family, which belongs to the glycoside hydrolase 18 family. CHI3L2 is primarily involved in cartilage biogenesis and tissue remodeling. It is highly expressed in certain tissues, including the appendix and salivary glands.