CHIA Polyclonal antibody

• 

  WB analysis of mouse lung using 21484-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21484-1-AP (CHIA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 21484-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21484-1-AP (CHIA antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 21484-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach using 21484-1-AP (CHIA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human stomach using 21484-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach using 21484-1-AP (CHIA antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung using 21484-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 21484-1-AP (CHIA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung using 21484-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 21484-1-AP (CHIA antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 21484-1-AP

  Immunofluorescent analysis of HepG2 cells, using CHIA antibody 21484-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  IF Staining of HeLa using 21484-1-AP

  Immunofluorescent analysis of Hela cells, using CHIA antibody 21484-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

CHIA Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21484-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

TSA1902, Lung-specific protein TSA1902, Lung specific protein TSA1902, EC:3.2.1.14, AMCase

---

Tested Applications

• Positive WB detected in: mouse lung tissue
• Positive IHC detected in: human stomach tissue, human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

21484-1-AP targets CHIA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15767

  Product name: Recombinant human CHIA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-368 aa of BC036339

  Sequence: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA

• Full Name: chitinase, acidic
• Calculated Molecular Weight: 476 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC036339
• Gene Symbol: CHIA
• Gene ID (NCBI): 27159
• RRID: AB_10755301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZP6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Mol Biosci; Characterization of an Aging-Based Diagnostic Gene Signature and Molecular Subtypes With Diverse Immune Infiltrations in Atherosclerosis.; Authors - Lei Zhao
mouse	IF	Commun Biol; Elevated stress response marks deeply quiescent reserve cells of gastric chief cells; Authors - Daisuke Shiokawa
mouse	WB,IF	Eur J Immunol; Aspergillus fumigatus corneal infection is regulated by chitin synthases and by neutrophil-derived acidic mammalian chitinase.; Authors - Steven de Jesus Carrion