Filter: AllWB

WB analysis using 22066-1-AP (same clone as 22066-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 22066-1-AP (CHKB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22066-1-PBS in a different storage buffer formulation.

CHKB Polyclonal antibody, PBS Only

Name: CHKB Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 22066-1-PBS

CHKB Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22066-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

22066-1-PBS targets CHKB in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag17142 Product name: Recombinant human CHKB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC101488 Sequence: MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVL Predict reactive species
Full Name	choline kinase beta
Calculated Molecular Weight	395 aa, 45 kDa
Observed Molecular Weight	45 kDa
GenBank Accession Number	BC101488
Gene Symbol	CHKB
Gene ID (NCBI)	1120
RRID	AB_3669385
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y259
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™