Tested Applications
| Positive WB detected in | HEK-293 cells, HK-2 cells, HeLa cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10477-1-AP targets CHMP2A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0719 Product name: Recombinant human CHMP2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC002502 Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLR Predict reactive species |
| Full Name | chromatin modifying protein 2A |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC002502 |
| Gene Symbol | CHMP2A |
| Gene ID (NCBI) | 27243 |
| RRID | AB_2079470 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43633 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHMP2A, also known as Vps2-1, belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. CHMP2A is a component of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in the degradation of surface receptor proteins and the formation of endocytic multivesicular bodies (MVBs). It has been shown that CHMP2A can interact with and regulate the function of the AAA-ATPase VPS4B (PMID: 15173323). CHMP2A is also reported to be involved in HIV budding (PMID: 21396898; 23051622).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CHMP2A antibody 10477-1-AP | Download protocol |
| WB protocol for CHMP2A antibody 10477-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CHMP2A Polyclonal antibody (Cat# 10477-1-AP) has 74 citations across journals including Nature, Science, Cell, Nature Cell Biology, Nature Communications, Molecular Cell, Autophagy, Developmental Cell, EMBO Journal, Cell Reports, and PNAS. Research fields span ESCRT-III biology, autophagy, nuclear envelope reformation, lysosomal membrane repair, cytokinesis, stress granules, neurodegeneration, cancer immunology, and viral infection mechanisms.
| Species | Application | Title |
|---|---|---|
Nature Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
| ||
Science A p62-dependent rheostat dictates micronuclei catastrophe and chromosome rearrangements | ||
Cell Mammalian hybrid pre-autophagosomal structure HyPAS generates autophagosomes
|
Reviews
What customers say
Across five reviews, this CHMP2A antibody is well received for Western blot, with users reporting a clear band at the expected ~34 kDa molecular weight at dilutions of 1:500–1:1000 in melanoma and CAL51 cell lines. Two reviewers noted occasional nonspecific bands that could be reduced with optimization. One user also confirmed good performance in immunofluorescence on methanol-fixed HeLa cells at 1:300, showing clear staining of a dividing cell. Overall, the antibody is considered reliable with strong signal and manageable background.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jelan (Verified Customer) (01-14-2026) | When used in Western blotting, the CHMP2A antibody from Proteintech typically yields a clear band at the expected molecular weight with low background after optimization.
|
Haley (Verified Customer) (10-13-2025) | Works well for Western blot.
|
Matteo (Verified Customer) (01-09-2025) | The antibody performs well, showing a strong band at around 34 kDa, but it also detects several nonspecific bands
 |
Celine (Verified Customer) (12-20-2024) | works well, but an unspecific band
 |
Stephen (Verified Customer) (04-08-2019) | IF image of Methanol fixed a dividing HeLa cell Stained with CHMP2A antibody (green) and Tubulin Antibody (red)
 |
