CHOP/GADD153 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 81462-1-RR (same clone as 81462-1-PBS)

  Untreated and tunicamycin treated HeLa cells were subjected to SDS PAGE followed by western blot with 81462-1-RR (CHOP; GADD153 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81462-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 81462-1-RR (same clone as 81462-1-PBS)

  Untreated and tunicamycin treated Jurkat cells were subjected to SDS PAGE followed by western blot with 81462-1-RR (CHOP; GADD153 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81462-1-PBS in a different storage buffer formulation.

• 

  ChIP experiment of NIH/3T3 using 81462-1-RR (same clone as 81462-1-PBS)

  Chromatin was prepared from NIH/3T3 cells treated with Tunicamycin (2ug/ml, overnigh). Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 20 µg of cross-linked chromatin, 5 µg of CHOP (81462-1-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 81462-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81462-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81462-1-RR against Human CHOP/GADD153 were performed. The affinity constant is 104 nM.

CHOP/GADD153 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA, ChIP-qPCR

Cat No. 81462-1-PBS

Clone No.1G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA, ChIP-qPCR

Synonyms

CHOP; GADD153, CHOP, DDIT3, GADD153, 1G11

---

Product Information

81462-1-PBS targets CHOP/GADD153 in WB, Indirect ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7354

  Product name: Recombinant human CHOP; GADD153 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-169 aa of BC003637

  Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

• Full Name: DNA-damage-inducible transcript 3
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC003637
• Gene Symbol: CHOP
• Gene ID (NCBI): 1649
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35638
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942).