CHORDC1 Polyclonal antibody

• 

  WB analysis using 25525-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25525-1-AP (CHORDC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 25525-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HEK-293 cells using CHORDC1 antibody (25525-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

CHORDC1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25525-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CHP-1, CHP1, CHP 1, CHORD-containing protein 1, CHORD domain-containing protein 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25525-1-AP targets CHORDC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18315

  Product name: Recombinant human CHORDC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC072461

  Sequence: MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPAAKKQEKQKDATTD

• Full Name: cysteine and histidine-rich domain (CHORD)-containing 1
• Calculated Molecular Weight: 332 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC072461
• Gene Symbol: CHORDC1
• Gene ID (NCBI): 26973
• RRID: AB_2918091
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHD1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.