CHP Polyclonal antibody

• 

CHP Polyclonal Antibody for ELISA

Cat No. 15834-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Calcineurin B homolog, Calcineurin homologous protein, Calcium binding protein CHP, calcium binding protein P22, CHP, SLC9A1BP

---

Product Information

15834-1-AP targets CHP in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8488

  Product name: Recombinant human CHP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-66 aa of BC008373

  Sequence: MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS

• Full Name: calcium binding protein P22
• Calculated Molecular Weight: 66 aa, 7 kDa
• GenBank Accession Number: BC008373
• Gene Symbol: CHP
• Gene ID (NCBI): 11261
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99653
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.