CHRNA1 Polyclonal antibody

• 

  WB analysis of mouse heart using 10613-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 10613-1-AP (CHRNA1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat heart using 10613-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 10613-1-AP (CHRNA1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 10613-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 10613-1-AP (CHRNA1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 10613-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 10613-1-AP (CHRNA1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skeletal muscle using 10613-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10613-1-AP (CHRNA1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 10613-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10613-1-AP (CHRNA1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human heart using 10613-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 10613-1-AP (CHRNA1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human heart using 10613-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 10613-1-AP (CHRNA1 Antibody) at dilution of 1:50 (under 10x lens).

CHRNA1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10613-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ACHRA, CHNRA

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IHC detected in: mouse skeletal muscle tissue, human heart tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IHC: See 3 publications below

Product Information

10613-1-AP targets CHRNA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0933

  Product name: Recombinant human CHRNA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-269 aa of BC006314

  Sequence: MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGGCGCHDCCC

• Full Name: cholinergic receptor, nicotinic, alpha 1 (muscle)
• Calculated Molecular Weight: 54.5 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC006314
• Gene Symbol: CHRNA1
• Gene ID (NCBI): 1134
• RRID: AB_2877737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02708
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Aging (Albany NY); A five-m6A regulatory gene signature is a prognostic biomarker in lung adenocarcinoma patients.; Authors - Xiao Wu
mouse	WB	Aging (Albany NY); Maternal high sugar and fat diet benefits offspring brain function via targeting on the gut-brain axis.; Authors - Dongdong Wang
mouse	WB	Transl Psychiatry; A diet high in sugar and fat influences neurotransmitter metabolism and then affects brain function by altering the gut microbiota.; Authors - Yinrui Guo
human	WB	Sci Rep; Liprin-α-1 is a novel component of the murine neuromuscular junction and is involved in the organization of the postsynaptic machinery.; Authors - Krzysztof M Bernadzki
rat	WB	Front Pharmacol; Miya Improves Osteoarthritis Characteristics via the Gut-Muscle-Joint Axis According to Multi-Omics Analyses.; Authors - Tianyang Xu
mouse	WB	Sci Rep; An improved method for culturing myotubes on laminins for the robust clustering of postsynaptic machinery.; Authors - Marcin Pęziński