CHRNA3 Polyclonal antibody

• 

  WB analysis using 10333-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 10333-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10333-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10333-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10333-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 10333-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10333-1-AP (CHRNA3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 10333-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10333-1-AP (CHRNA3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 10333-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10333-1-AP (CHRNA3 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

CHRNA3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10333-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Neuronal acetylcholine receptor subunit alpha-3, NACHRA3

---

Tested Applications

• Positive WB detected in: A549 cells, mouse brain tissue, HepG2 cells, mouse thymus tissue, HEK-293 cells
• Positive IHC detected in: mouse brain tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• FC: See 1 publications below

Product Information

10333-1-AP targets CHRNA3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0272

  Product name: Recombinant human CHRNA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-238 aa of BC000513

  Sequence: EAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIR

• Full Name: cholinergic receptor, nicotinic, alpha 3
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000513
• Gene Symbol: CHRNA3
• Gene ID (NCBI): 1136
• RRID: AB_2080511
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32297
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHRNA3, also named as NACHRA3, LNCR2 and PAOD2, is neuronal type nAChR subunits. It is a member of the nicotinic acetylcholine receptor family, which plays an important role in calcium regulation, neuronal development, and cognitive functions. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
zebrafish	WB	Acta Pharmacol Sin; Ursolic acid derivative UA312 ameliorates ionizing radiation-induced cardiotoxicity and neurodevelopmental toxicity in zebrafish via targeting chrna3 and grik5; Authors - Fei-Fei Xu
human	WB	Hum Mol Genet; Transcriptome analysis and molecular signature of human retinal pigment epithelium.; Authors - Strunnikova N V NV
human	WB	J Invest Dermatol; Chrna5 is overexpressed in psoriasis patients and promotes psoriasis-like inflammation in mouse models.; Authors - Jing Wang
mouse	IHC	FASEB J; The gut-brain axis rewired: adding a functional vagal nicotinic "sensory synapse"; Authors - Azucena Perez-Burgos
human	FC	Mar Drugs; Differential Expression of Nicotine Acetylcholine Receptors Associates with Human Breast Cancer and Mediates Antitumor Activity of αO-Conotoxin GeXIVA.; Authors - Zhihua Sun
human	WB	PLoS One; Nicotine Activates YAP1 through nAChRs Mediated Signaling in Esophageal Squamous Cell Cancer (ESCC).; Authors - Yue Zhao ; KD Validated