CHRNA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CHRNA3 Polyclonal antibody (10333-1-AP)

• Featured Product
• KD/KO Validated

CHRNA3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10333-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Neuronal acetylcholine receptor subunit alpha-3, NACHRA3

• 

  WB analysis using 10333-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 10333-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10333-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10333-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10333-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10333-1-AP (CHRNA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 10333-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10333-1-AP (CHRNA3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 10333-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10333-1-AP (CHRNA3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10333-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10333-1-AP (CHRNA3 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CHRNA3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse brain tissue, HepG2 cells, mouse thymus tissue, HEK-293 cells
• Positive IHC detected in: mouse brain tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10333-1-AP targets CHRNA3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0272

  Product name: Recombinant human CHRNA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-238 aa of BC000513

  Sequence: EAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIR

• Full Name: cholinergic receptor, nicotinic, alpha 3
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000513
• Gene Symbol: CHRNA3
• Gene ID (NCBI): 1136
• RRID: AB_2080511
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32297
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHRNA3, also named as NACHRA3, LNCR2 and PAOD2, is neuronal type nAChR subunits. It is a member of the nicotinic acetylcholine receptor family, which plays an important role in calcium regulation, neuronal development, and cognitive functions. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer.

Publications

What published studies show

The CHRNA3 antibody (Cat# 10333-1-AP) has 12 total citations spanning journals including Nature Biotechnology, Autophagy, Advanced Science, Acta Pharmacologica Sinica, Journal of Investigative Dermatology, Marine Drugs, FASEB Journal, Frontiers in Neuroscience, Human Molecular Genetics, PLoS One, Biochemical and Biophysical Research Communications, and STAR Protocols. Research fields cover RNA-protein interactions, autophagy, neuroscience, pharmacology, dermatology, oncology, gut-brain axis, autoimmune neurology, transcriptomics, liver fibrosis, and stem cell biology.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Biotechnol; Genome-wide mapping of RNA-protein associations through sequencing; Authors - Zhijie Qi
		Autophagy; E-cigarette aerosols induce the hydrolysis of lysosomal glycerophospholipids through PLA2G4A activation initiated by nicotine binding to CHRNA3/α3 nAchr in airway epithelial cells.; Authors - Yongquan Yu
mouse	IHC	Adv Sci (Weinh); An Activity-Dependent NEPAS-PTX3 Axis Links Neurovascular and Myelin Deficits to Cognitive Impairment.; Authors - Boya Hu
zebrafish	WB	Acta Pharmacol Sin; Ursolic acid derivative UA312 ameliorates ionizing radiation-induced cardiotoxicity and neurodevelopmental toxicity in zebrafish via targeting chrna3 and grik5; Authors - Fei-Fei Xu
human	WB	J Invest Dermatol; Chrna5 is overexpressed in psoriasis patients and promotes psoriasis-like inflammation in mouse models.; Authors - Jing Wang
human	FC	Mar Drugs; Differential Expression of Nicotine Acetylcholine Receptors Associates with Human Breast Cancer and Mediates Antitumor Activity of αO-Conotoxin GeXIVA.; Authors - Zhihua Sun