CHRNA3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01633-3

  Sandwich ELISA standard curve of MP01633-3, Human CHRNA3 Recombinant Matched Antibody Pair - PBS only. 84860-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0272. 84860-4-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL.

• 

  Sample test of MP01633-3

  The mean CHRNA3 concentration was determined to be 38.77 ng/mL in A549 cell extract based on a 1.50 mg/mL extract load, 29.25 ng/mL in HepG2 cell extract based on a 1.00 mg/mL extract load and 38.10 ng/mL in HEK-293 cell extract based on a 2.90 mg/mL extract load.

CHRNA3 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84860-1-PBS

Clone No.242410A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

NACHRA3, Neuronal acetylcholine receptor subunit alpha-3

---

Product Information

84860-1-PBS targets CHRNA3 as part of a matched antibody pair:

MP01633-3: 84860-1-PBS capture and 84860-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0272

  Product name: Recombinant human CHRNA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-238 aa of BC000513

  Sequence: EAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIR

• Full Name: cholinergic receptor, nicotinic, alpha 3
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: BC000513
• Gene Symbol: CHRNA3
• Gene ID (NCBI): 1136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P32297
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.