CHRNA4 Polyclonal antibody

• 

  WB analysis using 21939-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21939-1-AP (CHRNA4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

CHRNA4 Polyclonal Antibody for WB, ELISA

Cat No. 21939-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, Mouse

Applications

WB, ELISA

Synonyms

BFNC, CHRNA4, EBN, EBN1, NACHR, NACHRA4, NACRA4

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21939-1-AP targets CHRNA4 in WB, ELISA applications and shows reactivity with human, Mouse samples.

• Tested Reactivity: human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16584

  Product name: Recombinant human CHRNA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 334-573 aa of BC096290

  Sequence: SPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQY

• Full Name: cholinergic receptor, nicotinic, alpha 4
• Calculated Molecular Weight: 627 aa, 70 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC096290
• Gene Symbol: CHRNA4
• Gene ID (NCBI): 1137
• RRID: AB_3085680
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43681
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Neuromolecular Med; Hypertension Induces Cognitive Impairment and Alterations of Acetylcholine Receptor mRNA Expression in the Hippocampus and Cortex of Mice; Authors - Jingfeng Liu