CHRNA5 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CHRNA5 Monoclonal antibody (66363-1-Ig)

• Featured Product
• KD/KO Validated

CHRNA5 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66363-1-Ig Copied!

Clone No. 3G8C11

Publications (16)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

CHRNA5, LNCR2, NACHRA5

• 

  WB analysis of mouse skeletal muscle using 66363-1-Ig

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig skeletal muscle using 66363-1-Ig

  pig skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 66363-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C2C12 using 66363-1-Ig

  C2C12 cell were subjected to SDS PAGE followed by western blot with 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 66363-1-Ig

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bladder using 66363-1-Ig

  Immunohistochemical analysis of paraffin-embedded human bladder tissue slide using 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bladder using 66363-1-Ig

  Immunohistochemical analysis of paraffin-embedded human bladder tissue slide using 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 66363-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 66363-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 66363-1-Ig (CHRNA5 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CHRNA5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, C2C12 cell, pig skeletal muscle tissue, A549 cells
• Positive IHC detected in: human bladder tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66363-1-Ig targets CHRNA5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4447

  Product name: Recombinant human CHRNA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-251 aa of BC033639

  Sequence: GAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPL

• Full Name: cholinergic receptor, nicotinic, alpha 5
• Calculated Molecular Weight: 468 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC033639
• Gene Symbol: CHRNA5
• Gene ID (NCBI): 1138
• RRID: AB_2881743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30532
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. Variants in the CHRNA5 gene are associated with nicotine dependence and lung cancer risk.

Publications

What published studies show

Anti-CHRNA5 antibody (Cat# 66363-1-Ig) has 16 citations across 14 journals including Cell Death & Disease, Cell Communications & Signaling, Journal of Investigative Dermatology, Cell Molecular Life Sciences, Communications Biology, Cancer Immunology & Immunotherapy, Toxicology, Carcinogenesis, Neuromolecular Medicine, Clinical & Experimental Metastasis, Molecular Carcinogenesis, Food and Chemical Toxicology, Human Cell, and Archives of Dermatological Research. Research fields primarily focus on nicotine-related lung adenocarcinoma progression, immune escape, head and neck cancer, psoriasis, melanoma, and neurobiology.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; Nicotine-induced CHRNA5 activation modulates CES1 expression, impacting head and neck squamous cell carcinoma recurrence and metastasis via MEK/ERK pathway; Authors - Chen Feng
human	IHC	Cell Commun Signal; Alpha5 nicotinic acetylcholine receptor mediated immune escape of lung adenocarcinoma via STAT3/Jab1-PD-L1 signalling; Authors - Ping Zhu
human,mouse	IHC	J Invest Dermatol; Chrna5 is overexpressed in psoriasis patients and promotes psoriasis-like inflammation in mouse models.; Authors - Jing Wang ; KD Validated
human,mouse	WB,IHC	Cell Mol Life Sci; Acetylcholine promotes chronic stress-induced lung adenocarcinoma progression via α5-nAChR/FHIT pathway; Authors - Yang Jiao ; KD Validated
human	WB,IHC,IF	Cancer Immunol Immunother; Nicotine promotes M2 macrophage polarization through α5-nAChR/SOX2/CSF-1 axis in lung adenocarcinoma; Authors - Guiyu Kang ; KD Validated
	WB	Commun Biol; Nicotinic acetylcholine receptors regulate growth hormone in pituitary somatotrophs of tigers; Authors - Lulu Liu