CHRNB2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CHRNB2 Polyclonal antibody (17844-1-AP)

CHRNB2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17844-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CHRNB2, EFNL3, nAChRB2

• 

  WB analysis of SH-SY5Y using 17844-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 17844-1-AP (CHRNB2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 17844-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17844-1-AP (CHRNB2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 17844-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 17844-1-AP (CHRNB2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 17844-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 17844-1-AP (CHRNB2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CHRNB2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, mouse brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17844-1-AP targets CHRNB2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12208

  Product name: Recombinant human CHRNB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-227 aa of BC075041

  Sequence: LLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYD

• Full Name: cholinergic receptor, nicotinic, beta 2 (neuronal)
• Calculated Molecular Weight: 502 aa, 57 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC075041
• Gene Symbol: CHRNB2
• Gene ID (NCBI): 1141
• RRID: AB_2878450
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17787
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CHRNB2 Polyclonal antibody (Cat# 17844-1-AP) has 2 citations. They appear in Neuromolecular Medicine (2025) and eLife (2024). The research fields span neuroscience and cell biology, covering topics such as hypertension-induced cognitive impairment with altered acetylcholine receptor expression in the brain, and Hsp47-mediated biogenesis of multi-subunit neuroreceptors in the endoplasmic reticulum.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Neuromolecular Med; Hypertension Induces Cognitive Impairment and Alterations of Acetylcholine Receptor mRNA Expression in the Hippocampus and Cortex of Mice; Authors - Jingfeng Liu
human	WB	Elife; Hsp47 promotes biogenesis of multi-subunit neuroreceptors in the endoplasmic reticulum; Authors - Ya-Juan Wang