CHRNB3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHRNB3 Polyclonal antibody, PBS Only (18037-1-PBS)

• 

  IHC staining of human cerebellum using 18037-1-AP (same clone as 18037-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 18037-1-AP (CHRNB3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18037-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 18037-1-AP (same clone as 18037-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 18037-1-AP (CHRNB3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18037-1-PBS in a different storage buffer formulation.

CHRNB3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 18037-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

18037-1-PBS targets CHRNB3 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12664

  Product name: Recombinant human CHRNB3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 29-234 aa of BC069681

  Sequence: EDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPL

• Full Name: cholinergic receptor, nicotinic, beta 3
• Calculated Molecular Weight: 458 aa, 53 kDa
• GenBank Accession Number: BC069681
• Gene Symbol: CHRNB3
• Gene ID (NCBI): 1142
• RRID: AB_2878486
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05901
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.