CHRNB4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CHRNB4 Polyclonal antibody (22192-1-AP)

• Featured Product
• KD/KO Validated

CHRNB4 Polyclonal Antibody for WB, ELISA

Cat No. 22192-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CHRNB 4, Neuronal acetylcholine receptor subunit beta-4

• 

  WB analysis of SH-SY5Y using 22192-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 22192-1-AP (CHRNB4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 22192-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22192-1-AP (CHRNB4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 22192-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 22192-1-AP (CHRNB4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of SH-SY5Y using 22192-1-AP

  1x10^6 SH-SY5Y cells were surface stained with 0.4 ug CHRNB4 Polyclonal antibody (22192-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CHRNB4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, HeLa cells, mouse testis tissue
• Positive FC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22192-1-AP targets CHRNB4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16767

  Product name: Recombinant human CHRNB4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 332-451 aa of BC096080

  Sequence: WVKRCFLHKLPTFLFMKRPGPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVEDW

• Full Name: cholinergic receptor, nicotinic, beta 4
• Calculated Molecular Weight: 498 aa, 56 kDa
• Observed Molecular Weight: 48-60 kDa
• GenBank Accession Number: BC096080
• Gene Symbol: CHRNB4
• Gene ID (NCBI): 1143
• RRID: AB_11232227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30926
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CHRNB4 Polyclonal antibody (Cat# 22192-1-AP) has 5 total citations published in Science Advances, Marine Drugs (×2), European Journal of Pharmacology, and Cancers (Basel). The associated research fields span Parkinson's disease and mitochondrial dysfunction, breast cancer, cervical cancer, lung cancer, and head and neck cancer, with most studies utilizing Western blot to examine nicotinic acetylcholine receptor subunit expression and therapeutic targeting.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Adv; CHCHD2 mutant mice link mitochondrial deficits to PD pathophysiology.; Authors - Szu-Chi Liao
human		Mar Drugs; Differential Expression of Nicotine Acetylcholine Receptors Associates with Human Breast Cancer and Mediates Antitumor Activity of αO-Conotoxin GeXIVA.; Authors - Zhihua Sun
human	WB	Eur J Pharmacol; Identification of nicotinic acetylcholine receptor subunits in different lung cancer cell lines and the inhibitory effect of alpha-conotoxin TxID on lung cancer cell growth.; Authors - Jiang Qian
human	WB	Mar Drugs; Cervical Cancer Correlates with the Differential Expression of Nicotinic Acetylcholine Receptors and Reveals Therapeutic Targets.; Authors - Yiqiao Liu
human	WB	Cancers (Basel); An Integrated Genomic Strategy to Identify CHRNB4 as a Diagnostic/Prognostic Biomarker for Targeted Therapy in Head and Neck Cancer.; Authors - Yi-Hsuan Chuang ; KO Validated