CHST1 Polyclonal antibody

• 

  WB analysis of Jurkat using 12504-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12504-1-AP (CHST1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12504-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12504-1-AP (CHST1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

CHST1 Polyclonal Antibody for WB, ELISA

Cat No. 12504-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:2.8.2.21, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, GST-1, Keratan sulfate Gal-6 sulfotransferase, KS6ST

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12504-1-AP targets CHST1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3183

  Product name: Recombinant human CHST1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 62-411 aa of BC022567

  Sequence: HILILATTRSGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDLLRSLYDCDLYFLENYIKPPPVNHTTDRIFRRGASRVLCSRPVCDPPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLVRYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTVRNSAATAEKWRFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNPSVSLVEERDFRPFS

• Full Name: carbohydrate (keratan sulfate Gal-6) sulfotransferase 1
• Calculated Molecular Weight: 411 aa, 47 kDa
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: BC022567
• Gene Symbol: CHST1
• Gene ID (NCBI): 8534
• RRID: AB_2877862
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43916
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHST1 (Carbohydrate Sulfotransferase 1) exhibits galactose-6-sulfotransferase activity, High CHST1 expression is closely associated with poor prognosis in GC and is correlated with the infiltration of tumor immune cells. CHST1 is involved in the regulation of multiple oncogenes and tumor pathogenesis (PMID: 39944327).