CHST2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CHST2 Polyclonal antibody (26027-1-AP)

• Featured Product
• KD/KO Validated

CHST2 Polyclonal Antibody for WB, ELISA

Cat No. 26027-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

C6ST, EC:2.8.2.-, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2, GlcNAc6ST 1, GlcNAc6ST-1

• 

  WB analysis using 26027-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26027-1-AP (CHST2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 26027-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26027-1-AP (CHST2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CHST2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26027-1-AP targets CHST2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23293

  Product name: Recombinant human CHST2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 338-530 aa of BC105010

  Sequence: ASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

• Full Name: carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2
• Observed Molecular Weight: 50, 58-60 kDa
• GenBank Accession Number: BC105010
• Gene Symbol: CHST2
• Gene ID (NCBI): 9435
• RRID: AB_2880342
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4C5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHST2 encodes N-Acetylglucosamine-6-sulfotransferase-1 (GlcNAc6ST-1), a Golgi-resident glycoprotein that is responsible for sulfation of the L-selectin ligand on endothelial cells. Two isoforms of CHST2 exist due to the alternative splicing. This antibody recognizes both short form and long form, which migrates around 50-52 kDa and 58-60 kDa, respectively.

Publications

What published studies show

The CHST2 Polyclonal antibody (Cat# 26027-1-AP) has 1 total citation. It was cited in Cell Death & Disease (IF 12.2), in a 2023 study by Dan Zhang et al. The research field is breast cancer biology, specifically investigating how CHST2-mediated sulfation of MECA79 antigens contributes to breast cancer cell migration and metastasis. The antibody was used for Western blot (WB) on human samples with RNAi validation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; CHST2-mediated sulfation of MECA79 antigens is critical for breast cancer cell migration and metastasis; Authors - Dan Zhang ; KD Validated