CHSY1 Polyclonal antibody

• 

  WB analysis of mouse spleen using 14420-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 14420-1-AP (CHSY1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 14420-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14420-1-AP (CHSY1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 14420-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14420-1-AP (CHSY1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung cancer using 14420-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14420-1-AP (CHSY1 antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

CHSY1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14420-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Chondroitin sulfate synthase 1, Chondroitin synthase 1, CHSY, ChSy 1, ChSy-1

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, mouse heart tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

14420-1-AP targets CHSY1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5766

  Product name: Recombinant human CHSY1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 449-802 aa of BC046247

  Sequence: LDLLLLYKKHKGKKMTVPVRRHAYLQQTFSKIQFVEHEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRALALEVGSSQFNNESLLFFCDVDLVFTTEFLQRCRANTVLGQQIYFPIIFSQYDPKIVYSGKVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRVGGFDVSIQGWGLEDVDLFNKVVQAGLKTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCLGSKASTYGSTQQLAEMWLEKNDPSYSKSSNNNGSVRTA

• Full Name: chondroitin sulfate synthase 1
• Calculated Molecular Weight: 92 kDa
• Observed Molecular Weight: 60-92 kDa
• GenBank Accession Number: BC046247
• Gene Symbol: CHSY1
• Gene ID (NCBI): 22856
• RRID: AB_2079227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86X52
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Am J Hum Genet; Loss of CHSY1, a secreted FRINGE enzyme, causes syndromic brachydactyly in humans via increased NOTCH signaling.; Authors - Tian Jing J
mouse	IHC	Front Neurosci; Sleep and Memory Consolidation Dysfunction in Psychiatric Disorders: Evidence for the Involvement of Extracellular Matrix Molecules.; Authors - Barbara Gisabella
human	WB	Hum Cell; LncRNA LINC01094 contributes to glioma progression by modulating miR-224-5p/CHSY1 axis.; Authors - Luotong Liu
human	IHC	Oncotarget; Inflammatory microRNA-194 and -515 attenuate the biosynthesis of chondroitin sulfate during human intervertebral disc degeneration.; Authors - Bo Hu
mouse	IHC,WB	Adv Sci (Weinh); Sensory Nerve Maintains Intervertebral Disc Extracellular Matrix Homeostasis Via CGRP/CHSY1 Axis; Authors - Bo Hu ; KO Validated
rat	IF	Mater Today Bio; Hyaluronidase-responsive hydrogel loaded with magnetic nanoparticles combined with external magnetic stimulation for spinal cord injury repair; Authors - Zhiyi Fan