CHSY3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CHSY3 Polyclonal antibody (24444-1-AP)

• 

  WB analysis using 24444-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24444-1-AP (CHSY3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

CHSY3 Polyclonal Antibody for WB, ELISA

Cat No. 24444-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Carbohydrate synthase 2, chondroitin sulfate synthase 3, Chondroitin synthase 2, ChSy 2, CHSY2

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24444-1-AP targets CHSY3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19641

  Product name: Recombinant human CHSY3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 571-769 aa of BC137325

  Sequence: FFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFS

• Full Name: chondroitin sulfate synthase 3
• Calculated Molecular Weight: 882 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC137325
• Gene Symbol: CHSY3
• Gene ID (NCBI): 337876
• RRID: AB_3742114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q70JA7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHSY3 is a Golgi-localized chondroitin sulfate synthase that controls glycosaminoglycan chain elongation on extracellular matrix proteoglycans. By regulating chondroitin sulfate structure, CHSY3 influences matrix organization, growth factor signaling, and tissue mechanics. Its dysregulation is implicated in cartilage pathology, pulmonary remodeling, and cancer progression, highlighting CHSY3 as a key enzymatic regulator of extracellular matrix biology.