CIB2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CIB2 Polyclonal antibody (32585-1-AP)

• 

  WB analysis using 32585-1-AP

  Mouse heart tissue lysate was subjected to SDS PAGE followed by western blot with 32585-1-AP (CIB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

CIB2 Polyclonal Antibody for WB, ELISA

Cat No. 32585-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Calcium and integrin-binding family member 2, Kinase-interacting protein 2, KIP 2, KIP2

---

Tested Applications

• Positive WB detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32585-1-AP targets CIB2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38508

  Product name: Recombinant human CIB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of NM_006383.3

  Sequence: MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI*

• Full Name: calcium and integrin binding family member 2
• Calculated Molecular Weight: 22 kDa，187aa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: NM_006383.3
• Gene Symbol: CIB2
• Gene ID (NCBI): 10518
• RRID: AB_3742663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75838
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The CIB (calcium and integrin binding) protein family has 4 members (CIB1-CIB4), each composed of 4 EF-hand Ca2+-binding motifs (PMID: 27771768). CIB2 is broadly expressed in a variety of tissues, which plays a role in sensory neurons of the ear and eye involved in the regulation of Ca2+ homeostasis (PMID: 28663585; 29084757; 29255404). Mutations of CIB2 have been associated with autosomal recessive nonsyndromic deafness 48 (DFNB48), as well as syndromic deafness in Usher syndrome, type 1J (USH1J) (PMID: 23331261). The observed molecular weight of CIB2 is 39 kDa because it can form a dimer (PMID: 30174586).