CIDEA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CIDEA Polyclonal antibody (13170-1-AP)

CIDEA Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13170-1-AP Copied!

Publications (30)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Cell death activator CIDE-A, Cell death-inducing DFFA-like effector A, CIDE A, Lipid transferase CIDEA

• 

  WB analysis using 13170-1-AP

  human adipose were subjected to SDS PAGE followed by western blot with 13170-1-AP (CIDEA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 13170-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 13170-1-AP (CIDEA antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brown adipose using 13170-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 13170-1-AP (CIDEA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brown adipose using 13170-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 13170-1-AP (CIDEA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CIDEA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human adipose tissue, mouse heart tissue
• Positive IHC detected in: mouse brown adipose tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13170-1-AP targets CIDEA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3824

  Product name: Recombinant human CIDEA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-253 aa of BC031896

  Sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG

• Full Name: cell death-inducing DFFA-like effector a
• Calculated Molecular Weight: 253 aa, 28 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC031896
• Gene Symbol: CIDEA
• Gene ID (NCBI): 1149
• RRID: AB_10642957
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60543
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cell death-inducing DNA fragmentation factor (DFFA)-like effector (CIDE) family proteins, including Cidea, Cideb, and Fsp27 (Cidec), are lipid droplet (LD)-associated proteins playing important roles in LD fusion, lipid secretion, and very-low-density-lipoprotein (VLDL) maturation. Cidea is highly enriched in adult brown adipose tissue (BAT), and its deficiency results in the accumulation of smaller LDs in brown adipocytes, improved INS sensitivity, and resistance to diet-induced obesity. The MW of this protein is 25 kDa, and this antibody specially recognises the 25 kDa protein.

Publications

What published studies show

The CIDEA antibody (Cat# 13170-1-AP) has 30 citations spanning journals including Nature, Nat Commun, Signal Transduct Target Ther, Adv Sci, EMBO J, Dev Cell, Diabetes, Cancer Biol Ther, Int Immunopharmacol, Front Pharmacol, Sci Rep, and others. Research fields cover adipose thermogenesis/browning, lipid metabolism, obesity, MASLD/hepatic steatosis, gut microbiota modulation, cancer biology, and cardiovascular disease. Applications are predominantly WB, with some IF and IHC.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; GRP75 triggers white adipose tissue browning to promote cancer-associated cachexia; Authors - Xu Chen
mouse	WB	Nature; CLSTN3β enforces adipocyte multilocularity to facilitate lipid utilization; Authors - Kevin Qian
mouse	IF	Nat Commun; Dynamic enlargement and mobilization of lipid droplets in pluripotent cells coordinate morphogenesis during mouse peri-implantation development.; Authors - King Hang Tommy Mau
mouse	WB,IF	Adv Sci (Weinh); Cidea Targeting Protects Cochlear Hair Cells and Hearing Function From Drug- and Noise-Induced Damage.; Authors - Shasha Zhang ; KO Validated
mouse	WB	Adv Sci (Weinh); PWWP2B Fine-Tunes Adipose Thermogenesis by Stabilizing HDACs in a NuRD Subcomplex.; Authors - Linyu Yan
mouse	WB	Phytomedicine; Ban-xia-xie-xin-tang ameliorates hepatic steatosis by regulating Cidea and Cidec expression in HFD-fed mice; Authors - Qing-Song Xia