CISD2 Recombinant monoclonal antibody, PBS Only

CISD2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 82802-10-PBS
Clone No.6H13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Miner1, ERIS, CDGSH2, CDGSH iron-sulfur domain-containing protein 2, CDGSH iron sulfur domain 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82802-10-PBS targets CISD2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4172

Product name: Recombinant human CISD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 61-135 aa of BC032300

Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV

Predict reactive species
Full Name CDGSH iron sulfur domain 2
Calculated Molecular Weight 135 aa, 15 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC032300
Gene Symbol CISD2
Gene ID (NCBI) 493856
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N5K1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CISD2 gene encodes a 15 kDa CDGSH iron-sulfur domain-containing protein 2, which is also named Miner1 or NAF-1, this protein was reported on endoplasmic reticulum membrane or mitochondrion outer membrane. Defects in CISD2 are the cause of Wolfram syndrome type 2 (WFS2), a rare disorder characterized by juvenile-onset insulin-dependent diabetes mellitus with optic atrophy. CISD2 regulates autophagy program by interacting BCL2, contributing to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum.

Loading...
||
New chat Able
正在加载,请稍候...