CKMT1A Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CKMT1A Recombinant monoclonal antibody, PBS Only (83750-4-PBS)

• 

  WB analysis using 83750-4-RR (same clone as 83750-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83750-4-RR (CKMT1A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83750-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83750-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83750-4-RR against Human CKMT1A were performed. The affinity constant is 2.86 nM.

CKMT1A Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83750-4-PBS

Clone No.240825A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CKMT1B, CKMT1, CKMT, CKMiMi, Acidic-type mitochondrial creatine kinase

---

Product Information

83750-4-PBS targets CKMT1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7583

  Product name: Recombinant human CKMT1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 41-417 aa of BC001926

  Sequence: SERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

• Full Name: creatine kinase, mitochondrial 1A
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC001926
• Gene Symbol: CKMT1A
• Gene ID (NCBI): 548596
• RRID: AB_3671346
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P12532
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CKMT1A(Creatine kinase U-type, mitochondrial) is also named CKMT and belongs to the ATP:guanido phosphotransferase family. CKMT1A is a nearly identical copy of the CKMT1B gene. Both genes encode an identical CKMT1 protein(PMID:17098888). It reversibly catalyzes the transfer of phosphate between ATP and various phosphates. It has 2 isoforms produced by alternative splicing with the molecular weight of 47 kDa and 50 kDa.