CLCN7 Polyclonal antibody

• 

  WB analysis using 29230-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29230-1-AP (CLCN7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

CLCN7 Polyclonal Antibody for WB, ELISA

Cat No. 29230-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

OPTA2, H(+)/Cl(-) exchange transporter 7, ClC-7, CLC7, CLC 7

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse kidney tissue, mouse small intestine mouse small intestine, rat small intestine rat small intestine

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29230-1-AP targets CLCN7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29882

  Product name: Recombinant human CLCN7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-126 aa of BC012737

  Sequence: MANVSKKVSWSGRDRDDEEAAPLLRRTARPGGGTPLLNGAGPGAARQSPRSALFRVGHMSSVELDDELLDPDMDPPHPFPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRINHTAFRTVEIKR

• Full Name: chloride channel 7
• Calculated Molecular Weight: 805 aa, 89 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC012737
• Gene Symbol: CLCN7
• Gene ID (NCBI): 1186
• RRID: AB_3669678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51798
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The intracellular CLC chloride channel family members ClC-3, ClC-4, and ClC-5 have been proposed as the primary endosomal chloride conductance providers. ClC-7 is expressed in late endosomes and lysosomes, but there is disagreement in the literature regarding its contribution to acidification. More recently, the cystic fibrosis (CF) transmembrane conductance regulator chloride channel (CFTR) was proposed as the specific counter-ion conductance necessary for lysosomal acidification in alveolar macrophages. (PMID: 20566682)