Product Information
83028-1-PBS targets CLDN18 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34049 Product name: Recombinant human CLDN18 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-31 aa of NM_001002026 Sequence: MAVTACQGLGFVVSLIGIAGIIAATCMDQWSGSMAVTACQGLGFVVSLIGIAGIIAATCMDQWSGSMAVTACQGLGFVVSLIGIAGIIAATCMDQWS Predict reactive species |
| Full Name | claudin 18 |
| Calculated Molecular Weight | 28 kDa |
| GenBank Accession Number | NM_001002026 |
| Gene Symbol | CLDN18 |
| Gene ID (NCBI) | 51208 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P56856-2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
