Claudin 5 Recombinant monoclonal antibody, PBS Only

Name: Claudin 5 Recombinant monoclonal antibody, PBS Only,
Brand: Proteintech

Claudin 5 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83046-1-PBS

Clone No. 230250B8

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

CLDN5, AWAL, BEC1, Claudin5, Claudin-5

Formulation: PBS Only

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllAffinity

Affinity of 83046-1-PBS
Biolayer interferometry (BLl) kinetic assay of 83046-1-PBS against Human Claudin 5 was performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Claudin 5 in ?

83046-1-PBS targets Claudin 5 in Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag29044 Product name: Recombinant human CLDN5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 144-218 aa of BC032363 Sequence: VREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV Predict reactive species
Full Name	claudin 5
Calculated Molecular Weight	218 aa, 23 kDa
GenBank Accession Number	BC032363
Gene Symbol	CLDN5
Gene ID (NCBI)	7122
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O00501
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.