CLEC10A/CD301 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CLEC10A/CD301 Polyclonal antibody (13590-1-AP)

CLEC10A/CD301 Polyclonal Antibody for WB, ELISA

Cat No. 13590-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CLEC10A, CD301, CLECSF13, CLECSF14, C-type lectin domain family 10 member A

• 

  WB analysis of BxPC-3 using 13590-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 13590-1-AP (CLEC10A/CD301 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CLEC10A/CD301 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13590-1-AP targets CLEC10A/CD301 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4490

  Product name: Recombinant human CLEC10A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 66-316 aa of BC039011

  Sequence: QRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

• Full Name: C-type lectin domain family 10, member A
• Calculated Molecular Weight: 316 aa, 35 kDa
• Observed Molecular Weight: 32 kDa, 28 kDa
• GenBank Accession Number: BC039011
• Gene Symbol: CLEC10A
• Gene ID (NCBI): 10462
• RRID: AB_2083131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUN9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C-type lectin domain family 10 member A (CLEC10A), also known as CD301, macrophage galactose-type C-type lectin (MGL), DC-asialoglyco protein receptor (DC-ASGP-R) or human macrophage lectin (HML), is a type II transmembrane glycoprotein having a calcium-dependent carbohydrate recognition domain (PMID: 8598452; 11919201; 11698450). CLEC10A is expressed exclusively by myeloid professional antigen-presenting cells such as immature dendritic cells (DCs) and alternatively activated macrophages (PMID: 16998493). CLEC10A is a marker for human CD1c+ DCs (cDC2) (PMID: 29755453). It functions as an endocytic receptor for glycosylated antigens (PMID: 11919201).

Publications

What published studies show

The CLEC10A/CD301 polyclonal antibody (Cat# 13590-1-AP) has 1 total citation. It was cited in Frontiers in Immunology (2025), a study on machine learning identification of metabolic biomarkers linked to macrophage polarization in rectal cancer prognosis. The research fields associated with this citation include immunology, cancer biology, and macrophage biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Immunol; Machine learning identifies PYGM as a macrophage polarization-linked metabolic biomarker in rectal cancer prognosis.; Authors - Chengyuan Xu