CLEC16A Polyclonal antibody

• 

  WB analysis of mouse spleen using 26257-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 26257-1-AP (CLEC16A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 26257-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26257-1-AP (CLEC16A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26257-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26257-1-AP (CLEC16A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CLEC16A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26257-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CLEC16A, Gop 1, KIAA0350, Protein CLEC16A

---

Tested Applications

• Positive WB detected in: mouse spleen tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26257-1-AP targets CLEC16A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24268

  Product name: Recombinant human CLEC16A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC112897

  Sequence: MFGRSRSWVGGGHGKTSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIWGDQNDSSVFDFFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSNNYVNSIIVHKFDFSDEEIMAYYISFLKTLSLKLNNHTVHFFYNEHTNDFALYTEAIKFFNHPESMVRIAVRTITLNVYKVDNQAMLHYIRDKTAVPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSEMYAKTEQD

• Full Name: C-type lectin domain family 16, member A
• Calculated Molecular Weight: 1053 aa, 118 kDa
• Observed Molecular Weight: 104-110 kDa
• GenBank Accession Number: BC112897
• Gene Symbol: CLEC16A
• Gene ID (NCBI): 23274
• RRID: AB_2880449
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2KHT3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.