CLEC16A Fusion Protein

Catalog number: Ag24268

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Powder

Please visit your regions distributor:


You can also
Request A Quote

Images See all

CLEC16A fusion protein Ag24268 SDS-PAGE


Product Name:
human CLEC16A-6*His fusion protein

Catalog No:
Ag24268

Source:
E. coli-derived, PET28a

Peptide Sequence:
MFGRSRSWVGGGHGKTSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIWGDQNDSSVFDFFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSNNYVNSIIVHKFDFSDEEIMAYYISFLKTLSLKLNNHTVHFFYNEHTNDFALYTEAIKFFNHPESMVRIAVRTITLNVYKVDNQAMLHYIRDKTAVPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSEMYAKTEQD
(1 - 350 aa encoded by BC112897)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Purity:
75%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Back
to top