CLEC2L Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CLEC2L Recombinant monoclonal antibody, PBS Only (87144-1-PBS)

• 

  WB analysis using 87144-1-RR (same clone as 87144-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87144-1-RR (CLEC2L antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87144-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87144-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87144-1-RR against Human CLEC2L were performed. The affinity constant is below 1 pM.

CLEC2L Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87144-1-PBS

Clone No.252317D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

C-type lectin domain family 2 member L, C-Type Lectin Domain Family 2, Member L

---

Product Information

87144-1-PBS targets CLEC2L in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35450

  Product name: Recombinant human CLEC2L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-214 aa of NM_001080511.2

  Sequence: SKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSKMAYT

• Full Name: C-type lectin domain family 2, member L
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: NM_001080511.2
• Gene Symbol: CLEC2L
• Gene ID (NCBI): 154790
• RRID: AB_3745367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P0C7M8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C-type lectin domain family 2 member L (CLEC2L) is a membrane protein mainly expressed in brain tissue and probably has carbohydrate-binding activity. The CLEC2L-encoded C-type lectin-like receptors (CTLRs) are expressed as non-glycosylated, disulfide-linked homodimers at the cell surface, and designated as BACL (brain-associated C-type lectin) (PMID: 23776472). The CLEC2L protein has 214 amino acids with a predicted molecular mass of 23.9 kDa. Under non-reducing conditions, FLAG-tagged CLEC2L proteins appeared with a molecular mass of ~55 kDa in immunoblots because of the occurrence of disulfide-linked homodimers (PMID: 23776472).