CLEC3B Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP02030-3

  Sandwich ELISA standard curve of MP02030-3, Human Tetranectin Recombinant Matched Antibody Pair - PBS only. 85689-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3063. 85689-4-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL

• 

  Sample test of MP02030-3

  Serum of eight individual healthy human donors was measured. The human Tetranectin concentration of detected samples was determined to be 19,241.86 ng/mL with a range of 14,408.67 - 26,154.19 ng/mL.

CLEC3B Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85689-3-PBS

Clone No.243017A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

C-type lectin domain family 3 member B, Plasminogen kringle 4-binding protein, Tetranectin, TN, TNA

---

Product Information

85689-3-PBS targets CLEC3B as part of a matched antibody pair:

MP02030-3: 85689-3-PBS capture and 85689-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3063

  Product name: Recombinant Human CLEC3B protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-202 aa of NM_003278.2

  Sequence: EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

• Full Name: C-type lectin domain family 3, member B
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: NM_003278.2
• Gene Symbol: CLEC3B
• Gene ID (NCBI): 7123
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05452
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.