Anti-Mouse CLEC9A/CD370 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of BALB/c mouse splenocytes using 98395-1-RR (same clone as 98395-1-PBS)

  1x10^6 BALB/c mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CLEC9A Rabbit RecAb (98395-1-RR, Clone:242895F4) and PE-Conjugated Goat Anti-Rabbit IgG(H+L), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9). Cells were then stained with CoraLite® Plus 405 Anti-Mouse CD11c (N418) Mouse IgG2a Recombinant Antibody (CL405-65602, Clone: N418) and APC Anti-Mouse CD8a (5H10-1) (APC-65205, Clone: 5H10-1). CD8+ were gated. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98395-1-PBS in a different storage buffer formulation.

CLEC9A/CD370 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98395-1-PBS

Clone No.242895F4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD370, Clec9a, C-type lectin domain family 9 member A, Dendritic cell natural killer lectin group receptor 1, Dngr-1

---

Product Information

98395-1-PBS targets CLEC9A/CD370 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2730

  Product name: Recombinant Mouse Clec9a protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 57-264 aa of NM_001205363.1

  Sequence: KFFQVSSLVLEQQERLIQQDTALVNLTQWQRKYTLEYCQALLQRSLHSGTDASTGPVLLTSPQMVPQTLDSKETGSDCSPCPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLKDSTLISDKCDSWKYFICEKKAFGSCI

• Full Name: C-type lectin domain family 9, member a
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001205363.1
• Gene Symbol: Clec9a
• Gene ID (NCBI): 232414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8BRU4-4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CLEC9A (C-type lectin domain family 9 member A), also known as DNGR1, CD370, is a type II membrane protein that contains C-type lectin domain. The C-type lectin domain family members share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. Mouse Clec9A is primarily restricted to dendritic cells (DCs) and selectively expressed in mouse CD8+ conventional DCs (cDCs) and plasmacytoid DCs (pDCs), whereas human CLEC9A is also expressed on human DC subtypes. CLEC9A functions as an activating receptor that recruits Syk kinase and can induce the production of proinflammatory cytokines. (PMID: 25553393; PMID: 15476922; PMID: 18669894; PMID: 18408006)