Calmegin Polyclonal antibody

• 

  WB analysis of mouse testis using 12629-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12629-1-AP (Calmegin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 12629-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12629-1-AP (Calmegin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 12629-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 12629-1-AP (Calmegin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12629-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12629-1-AP (Calmegin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12629-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12629-1-AP (Calmegin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 12629-1-AP

  IP result of anti-Calmegin (IP:12629-1-AP, 4ug; Detection:12629-1-AP 1:1000) with mouse testis tissue lysate 4000ug.

• 

  IHC staining of human testis using 12629-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 12629-1-AP (Calmegin antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 12629-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 12629-1-AP (Calmegin antibody at dilution of 1:50 (under 40x lens).

Calmegin Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12629-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IF, IHC, ELISA

Synonyms

calmegin, CLGN

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human brain tissue, human lung tissue, mouse brain tissue, mouse lung tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

12629-1-AP targets Calmegin in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3322

  Product name: Recombinant human CLGN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 311-610 aa of BC028357

  Sequence: PAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD

• Full Name: calmegin
• Calculated Molecular Weight: 610 aa, 70 kDa
• Observed Molecular Weight: 93 kDa
• GenBank Accession Number: BC028357
• Gene Symbol: Calmegin
• Gene ID (NCBI): 1047
• RRID: AB_2276364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14967
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calmegin, belonging to the calreticulin family, is a testis-specific molecular chaperon of the endoplasmic reticulum playing a key role in spermatogenesis. Western blot analysis of mouse testis showed a single band with an apparent molecular mass of 93 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Cell Proteomics; Integrative proteomic and transcriptomic analyses reveal multiple post-transcriptional regulatory mechanisms of mouse spermatogenesis.; Authors - Haiyun Gan
mouse	IF	Sci Rep; Transcription Factor RFX2 Is a Key Regulator of Mouse Spermiogenesis.; Authors - Yujian Wu