Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, mouse kidney tissue, PC-3 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18094-1-AP targets CLOCK in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12826 Product name: Recombinant human CLOCK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC041878 Sequence: MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFISNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWL Predict reactive species |
| Full Name | clock homolog (mouse) |
| Calculated Molecular Weight | 846 aa, 95 kDa |
| Observed Molecular Weight | 95-110 kDa |
| GenBank Accession Number | BC041878 |
| Gene Symbol | CLOCK |
| Gene ID (NCBI) | 9575 |
| RRID | AB_2878497 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15516 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Circadian locomoter output cycles protein kaput (CLOCK), also named as BHLHE8 or KIAA0334, is a 846 amino acid protein, which contains one bHLH domain, one PAC domain, and two PAS domains. CLOCK localizes in the nucleus and cytoplasm. CLOCK) is expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ARNTL/2-CLOCK heterodimers activate E-box element (5'-CACGTG-3') transcription of a number of proteins of the circadian clock, such as PER1 and PER2. The calculated molecular weight of CLOCK is 95kDa, we detected a 95-110 kDa protein by western blot. Our result is similar to the result of reseach paper (PMID: 30683868).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CLOCK antibody 18094-1-AP | Download protocol |
| IHC protocol for CLOCK antibody 18094-1-AP | Download protocol |
| IP protocol for CLOCK antibody 18094-1-AP | Download protocol |
| WB protocol for CLOCK antibody 18094-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CLOCK Polyclonal antibody (Cat# 18094-1-AP) has 31 citations across journals including Nature, Cell Host Microbe, Nat Commun, Eur Heart J, Free Radic Biol Med, FASEB J, Cell Mol Life Sci, and Sci Rep. Research fields span circadian rhythm, lipid/glucose metabolism, cancer (ovarian, breast, bladder, liver, DLBCL), neuroinflammation, cardiovascular disease, aging, tuberculosis, PCOS, CKD, atherosclerosis, and environmental toxicology.
| Species | Application | Title |
|---|---|---|
Eur Heart J Circadian nuclear receptor Rev-erbα is expressed by platelets and potentiates platelet activation and thrombus formation | ||
Cell Host Microbe A CLOCK-targeting lncRNA induces trained immunity against tuberculosis. | ||
Nat Commun The rhythmic coupling of Egr-1 and Cidea regulates age-related metabolic dysfunction in the liver of male mice | ||
Cell Death Dis hPER3 promotes adipogenesis via hHSP90AA1-mediated inhibition of Notch1 pathway. | ||
J Neuroinflammation Repetitive unidirectional spinal tactile stimulation engages microglial Bmal1 pathways to promote synaptic remodeling in the mPFC of adolescent VPA-exposed mice. |
Reviews
What customers say
The single review for this antibody reports a 4-star rating from a Western Blot application at 1:1000 dilution on a lymphoblastic cell line. The reviewer found the bands clear with no background noise, even when the signal was not very strong, and overall rated it a good antibody.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Verdiana (Verified Customer) (05-03-2022) | The bands are clear, there is no background noise even if the bands signal is not very strong. Good Ab.
|
