Clusterin Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00986-3

  Sandwich ELISA standard curve of MP00986-3, Human Clusterin Recombinant Matched Antibody Pair - PBS only. 84067-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0225. 84067-3-PBS was HRP conjugated as the detection antibody. Range: 97.7-6250 pg/mL

• 

  Sample test of MP00986-3

  Serum of six individual healthy human donors was measured. The human Clusterin concentration of detected samples was determined to be 31,152.14 ng/mL with a range of 15,052.59 - 51,157.85 ng/mL.

• 

  Sample test of MP00986-3

  Saliva of four individual healthy human donors was measured. The human Clusterin concentration of detected samples was determined to be 152.81 ng/mL with a range of 95.56 - 231.47 ng/mL.

• 

  Sample test of MP00986-3

  Urine of four individual healthy human donors was measured. The human Clusterin concentration of detected samples was determined to be 40.81 ng/mL with a range of 16.72 - 69.41 ng/mL.

• 

  Sample test of MP00986-3

  HepG2 were cultured in DMEM supplemented with 10% fetal bonive serum, 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. An aliquot of the cell culture supernate was removed, assayed for human Clusterin, and measured 140.90 ng/mL.

Clusterin Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84067-1-PBS

Clone No.241277A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

AAG4, Aging-associated gene 4 protein, Apo J, APOJ, Apo-J

---

Product Information

84067-1-PBS targets Clusterin as part of a matched antibody pair:

MP00986-3: 84067-1-PBS capture and 84067-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0225

  Product name: Recombinant Human CLU protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-449 aa of BC010514

  Sequence: DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Full Name: clusterin
• Calculated Molecular Weight: 449 aa, 53 kDa
• GenBank Accession Number: BC010514
• Gene Symbol: CLU
• Gene ID (NCBI): 1191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10909
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.