CNDP1 Polyclonal antibody

CNDP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 17759-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

CPGL2, CNDP dipeptidase 1, CN1, Carnosine dipeptidase 1, Beta-Ala-His dipeptidase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A431 cells
Positive IHC detected inhuman prostate cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

17759-1-AP targets CNDP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12127

Product name: Recombinant human CNDP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 160-508 aa of BC110295

Sequence: YGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH

Predict reactive species
Full Name carnosine dipeptidase 1 (metallopeptidase M20 family)
Calculated Molecular Weight 508 aa, 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC110295
Gene Symbol CNDP1
Gene ID (NCBI) 84735
RRIDAB_2878435
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96KN2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta-Ala-His dipeptidase (CNDP1) encodes the secreted serum carnosinase, which is synthesized in the brain and secreted into the systematic circulation, CNDP1 hydrolyzes L-carnosine and is essential for glucose metabolism and the transportation of activated fatty acids across the mitochondrial membrane (PMID: 32111749, 16046297).

Protocols

Product Specific Protocols
IF protocol for CNDP1 antibody 17759-1-APDownload protocol
IHC protocol for CNDP1 antibody 17759-1-APDownload protocol
WB protocol for CNDP1 antibody 17759-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Amino Acids

Serum and urinary carnosinase-1 correlate with kidney function and inflammation

Authors - Shiqi Zhang
Loading...
||
New chat Able
正在加载,请稍候...