Tested Applications
| Positive IP detected in | HK-2 cells, mouse skin tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21425-1-AP targets CNFN in IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16012 Product name: Recombinant human CNFN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC101197 Sequence: MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE Predict reactive species |
| Full Name | cornifelin |
| Calculated Molecular Weight | 112 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC101197 |
| Gene Symbol | CNFN |
| Gene ID (NCBI) | 84518 |
| RRID | AB_3742032 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BYD5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CNFN (cornifelin, also termed PLAC8L2) is highly expressed in the esophagus and skin, and is located on chromosome 19q13.2 (PMID: 30816522).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for CNFN antibody 21425-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



