CNGA2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CNGA2 Polyclonal antibody (23823-1-AP)

• 

  WB analysis using 23823-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23823-1-AP (CNGA2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

CNGA2 Polyclonal Antibody for WB, ELISA

Cat No. 23823-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Cyclic nucleotide-gated channel alpha-2, CNG-2, CNG channel alpha-2, CNCG2, CNCA1

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23823-1-AP targets CNGA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19899

  Product name: Recombinant human CNGA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 575-664 aa of BC126302

  Sequence: REILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAAADEP

• Full Name: cyclic nucleotide gated channel alpha 2
• Calculated Molecular Weight: 664 aa, 76 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC126302
• Gene Symbol: CNGA2
• Gene ID (NCBI): 1260
• RRID: AB_3742092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q16280
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclic nucleotide-gated (CNG) channels are crucial for visual and olfactory transductions (PMID: 12432397). Native CNG channels are heterotetramers composed of homologous A and B subunits. The olfactory CNG channels are composed of two CNGA2 subunits, one CNGA4 and one CNGB1b subunit, each containing a cyclic nucleotide-binding domain (PMID: 22786723). CNGA2, also named as CNCA, CNCA1 and CNCG2, is the primary subunit of the olfactory CNG channel. Odorant signal transduction is probably mediated by a G-protein coupled cascade using cAMP as second messenger. Activation of olfactory channel by cyclic nucleotides leads to a depolarization of olfactory sensory neurons.