CNGA2 Polyclonal antibody

CNGA2 Polyclonal Antibody for WB, ELISA
Cat No. 23823-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Cyclic nucleotide-gated channel alpha-2, CNG-2, CNG channel alpha-2, CNCG2, CNCA1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HepG2 cells, mouse brain tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23823-1-AP targets CNGA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19899

Product name: Recombinant human CNGA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 575-664 aa of BC126302

Sequence: REILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAAADEP

Predict reactive species
Full Name cyclic nucleotide gated channel alpha 2
Calculated Molecular Weight 664 aa, 76 kDa
Observed Molecular Weight80 kDa
GenBank Accession NumberBC126302
Gene Symbol CNGA2
Gene ID (NCBI) 1260
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ16280
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclic nucleotide-gated (CNG) channels are crucial for visual and olfactory transductions (PMID: 12432397). Native CNG channels are heterotetramers composed of homologous A and B subunits. The olfactory CNG channels are composed of two CNGA2 subunits, one CNGA4 and one CNGB1b subunit, each containing a cyclic nucleotide-binding domain (PMID: 22786723). CNGA2, also named as CNCA, CNCA1 and CNCG2, is the primary subunit of the olfactory CNG channel. Odorant signal transduction is probably mediated by a G-protein coupled cascade using cAMP as second messenger. Activation of olfactory channel by cyclic nucleotides leads to a depolarization of olfactory sensory neurons.

Protocols

Product Specific Protocols
WB protocol for CNGA2 antibody 23823-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...