CNIH2 Polyclonal antibody

• 

  WB analysis using 14260-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14260-1-AP (CNIH2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 14260-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14260-1-AP (CNIH2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14260-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14260-1-AP (CNIH2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 14260-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CNIH2 antibody (14260-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

CNIH2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14260-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CNIH-2, CNIL, Cornichon family AMPA receptor auxiliary protein 2, Cornichon like protein, Cornichon-like protein

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, Rat brain tissue, Mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14260-1-AP targets CNIH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5533

  Product name: Recombinant human CNIH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC047953

  Sequence: MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWC

• Full Name: cornichon homolog 2 (Drosophila)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC047953
• Gene Symbol: CNIH2
• Gene ID (NCBI): 254263
• RRID: AB_3669181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PI25
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CNIH2, or cornichon family AMPA receptor auxiliary protein 2, is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype.CNIH2 has been reported to interact with the Type I AMPA Receptor regulatory protein isoform gamma-8, which controls the assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. It has been implicated in various diseases, including schizophrenia, as indicated by its association with different schizophrenia-related disorders.