CNIH2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CNIH2 Recombinant monoclonal antibody (87838-1-RR)

• 

  WB analysis using 87838-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87838-1-RR (CNIH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

CNIH2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87838-1-RR

Clone No.253503A7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CNIH-2, CNIL, Cornichon family AMPA receptor auxiliary protein 2, Cornichon like protein, Cornichon-like protein

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87838-1-RR targets CNIH2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5533

  Product name: Recombinant human CNIH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC047953

  Sequence: MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWC

• Full Name: cornichon homolog 2 (Drosophila)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC047953
• Gene Symbol: CNIH2
• Gene ID (NCBI): 254263
• RRID: AB_3745779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6PI25
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CNIH2, or cornichon family AMPA receptor auxiliary protein 2, is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype.CNIH2 has been reported to interact with the Type I AMPA Receptor regulatory protein isoform gamma-8, which controls the assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. It has been implicated in various diseases, including schizophrenia, as indicated by its association with different schizophrenia-related disorders.