CNN3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86550-3-RR (same clone as 86550-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86550-3-RR (CNN3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86550-3-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 86550-3-RR (same clone as 86550-3-PBS)

  IP result of anti-CNN3 (IP:86550-3-RR, 4ug; Detection:86550-3-RR 1:2000) with HEK-293 cells lysate 1200 ug. This data was developed using the same antibody clone with 86550-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86550-3-RR (same clone as 86550-3-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CNN3 antibody (86550-3-RR, Clone: 251475E9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86550-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86550-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86550-3-RR against Human CNN3 were performed. The affinity constant is 1.83 nM.

CNN3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 86550-3-PBS

Clone No.251475E9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

Calponin 3, Calponin3, Calponin-3, CNN 3

---

Product Information

86550-3-PBS targets CNN3 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2068

  Product name: Recombinant human CNN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-329 aa of BC025372

  Sequence: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY

• Full Name: calponin 3, acidic
• Calculated Molecular Weight: 329 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC025372
• Gene Symbol: CNN3
• Gene ID (NCBI): 1266
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15417
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain. CNN3 is the thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction.