Product Information
17935-1-PBS targets CNOT6 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11506 Product name: Recombinant human CNOT6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC027476 Sequence: MCIMTISSEGELELVGLMRLRKQLFLRSALCNHRSRELYGSGRGGALTHVVFVNGGCHLFIDAGTRVHLLDAKGLSFTQNVFICICYCLQYI Predict reactive species |
| Full Name | CCR4-NOT transcription complex, subunit 6 |
| Calculated Molecular Weight | 557 aa, 63.3 kDa |
| Observed Molecular Weight | 63 kDa |
| GenBank Accession Number | BC027476 |
| Gene Symbol | CNOT6 |
| Gene ID (NCBI) | 57472 |
| RRID | AB_2935444 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9ULM6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The evolutionarily conserved CCR4-NOT (CNOT) complex regulates mRNA metabolism in eukaryotic cells. This regulation occurs at different levels of mRNA synthesis and degradation, including transcription initiation, elongation, deadenylation, and degradation (PMID: 12882519). Multiple components, including CNOT1, CNOT2, CNOT3, CNOT4, CNOT6, CNOT6L, CNOT7, CNOT8, CNOT9, and CNOT10 have been identified in this complex (PMID: 19558367). In addition, the subunit composition of this complex has been shown to vary among different tissues (PMID: 21741365). The various CNOT proteins display different functions, with CNOT6, CNOT6L, CNOT7, and CNOT8 exhibiting 3'-5' RNAse activity (PMID: 11889047). Research studies indicate that the CCR4-NOT deadenylase subunits CNOT6 and CNOT6L help mediate cell survival and play a role in cell proliferation, P-body formation, and regulation of gene expression (PMID: 21233283). Additional research evidence suggests that CNOT6 can act as a nuclear hormone receptor coactivator that associates with ZNF335 (NIF-1) to regulate expression from specific RARα regulated genes (PMID: 18180299).
